PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC15257_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family HB-other
Protein Properties Length: 135aa    MW: 15240.2 Da    PI: 9.5123
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC15257_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.43.4e-204398257
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
     Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                  kR+  t+ ql++Le+++ ++ yps+++r+eL++kl+L++rq ++WF+ rR k+kk
  RrC15257_p1 43 PKRQMKTPFQLQTLEQVYSEETYPSEATRAELSEKLDLSDRQLQMWFCHRRLKDKK 98
                 69****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.42E-183598IPR009057Homeodomain-like
PROSITE profilePS5007116.3253999IPR001356Homeobox domain
SMARTSM003895.8E-1841103IPR001356Homeobox domain
PfamPF000467.4E-184398IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-184498IPR009057Homeodomain-like
CDDcd000868.37E-154498No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 135 aa     Download sequence    Send to blast
MEMGSDGEED HQIRNVAGES NHNNKNKKMK KVVVVETKDS PKPKRQMKTP FQLQTLEQVY  60
SEETYPSEAT RAELSEKLDL SDRQLQMWFC HRRLKDKKDG QVKKQPPKPS SSASLLPPAF  120
SSVNHLPPAA APAAE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19198RRLKDKKD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013731407.13e-51PREDICTED: uncharacterized protein LOC106435103 isoform X1
RefseqXP_013731408.13e-51PREDICTED: uncharacterized protein LOC106435103 isoform X2
SwissprotF4HY566e-42RLT1_ARATH; Homeobox-DDT domain protein RLT1
TrEMBLA0A0D3CEA58e-51A0A0D3CEA5_BRAOL; Uncharacterized protein
STRINGBra032908.1-P7e-47(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.11e-40homeobox-1